Search NASA⌕ Search

SEARCH · Search NASA

Results for “Spacecraft component”

Search indexed NASA NTRS and DOE OSTI research on propulsion, heat transfer, battery materials and energy systems. Follow report and document links to the original sources.

Quote a phrase for an exact phrase match. Source license links do not imply unrestricted reuse.

At least 361 records · Page 20
All sourcesNASA NTRSDOE OSTI
NASA NTRS2018

A Monte Carlo Approach to Measuring Trajectory Performance Subject to Missed Thrust

A spacecraft using solar electric propulsion (SEP) to reach its destination must operate its thrusters for very long periods of time compared to one using chemical propulsion. Some spacecraft may be required to thrust almost the entire duration of the transfer to reach their target. A side-effect of this characteristic of SEP missions is that a spacecraft could be subject to an anomaly or fault that forces it to stop thrusting when it should be, causing it to drift away from its nominal trajectory. A diagram of this situation is shownin Figure 1. Because these shut-down events (commonly referred to as safe mode or safing events), are not uncommon and can be caused by uncontrollable external factors (such as a cosmic ray striking an electronic component), the spacecraft and trajectory should be designed such that the spacecraft can continue on to its destination in a reasonable time and propellant expenditure once operations resume.

Laipert, Frank E.↗
NASA NTRS1991

Mars approach navigation using Doppler and range measurements to surface beacons and orbiting spacecraft

Approximate analytical models are developed and used to construct an error covariance analysis for investigating the range of orbit determination accuracies which might be achieved for typical Mars approach trajectories. The sensitivity or orbit determination accuracy to beacon/orbiter position errors and to small spacecraft force modeling errors is also investigated. The results indicate that the orbit determination performance obtained from both Doppler and range data is a strong function of the inclination of the approach trajectory to the Martian equator, for surface beacons, and for orbiters, the inclination relative to the orbital plane. Large variations in performance were also observed for different approach velocity magnitudes; Doppler data in particular were found to perform poorly in determining the downtrack (along the direction of flight) component of spacecraft position. In addition, it was found that small spacecraft acceleration modeling errors can induce large errors in the Doppler-derived downtrack position estimate.

Thurman, Sam W.↗
NASA NTRS1974

Development of integrated, zero-G pneumatic transporter/rotating paddle incinerator/catalytic afterburner subsystem for processing human wastes on board spacecraft

A four component system was developed which consists of a particle size reduction mechanism, a pneumatic waste transport system, a rotating-paddle incinerator, and a catalytic afterburner to be integrated into a six-man, zero-g subsystem for processing human wastes on board spacecraft. The study included the development of different concepts or functions, the establishment of operational specifications, and a critical evaluation for each of the four components. A series of laboratory tests was run, and a baseline subsystem design was established. An operational specification was also written in preparation for detailed design and testing of this baseline subsystem.

Fields, S. F.↗
NASA NTRS2005

Advanced Metal Foam Structures for Outer Space

A document discusses a proposal to use advanced materials especially bulk metallic glass (BMG) foams in structural components of spacecraft, lunar habitats, and the like. BMG foams, which are already used on Earth in some consumer products, are superior to conventional metal foams: BMG foams have exceptionally low mass densities and high strength-to-weight ratios and are more readily processable into strong, lightweight objects of various sizes and shapes. These and other attractive properties of BMG foams would be exploited, according to the proposal, to enable in situ processing of BMG foams for erecting and repairing panels, shells, containers, and other objects. The in situ processing could include (1) generation of BMG foams inside prefabricated deployable skins that would define the sizes and shapes of the objects thus formed and (2) thermoplastic deformation of BMG foams. Typically, the generation of BMG foams would involve mixtures of precursor chemicals that would be subjected to suitable pressure and temperature schedules. In addition to serving as structural components, objects containing or consisting of BMG foams could perform such functions as thermal management, shielding against radiation, and shielding against hypervelocity impacts of micrometeors and small debris particles.

Hanan, Jay↗
NASA NTRS1990

Selection of component modes for the simulation of flexible multibody spacecraft

This paper describes a procedure for the selection of component modes employed in discretization of component deformation in a flexible multibody spacecraft. The emphasis is placed on the selection of modes which adequately represent the interaction of the various on-board control systems with the vehicle structural flexibility. The method combines the component mode synthesis approaches of Craig-Bampton (1968), MacNeal (1971) and Rubin (1975), and Benfield-Hruda (1971) with the modal balancing method of Moore (1981) and Gregory (1984). The procedure, which is applicable to both articulating and nonarticulating systems, was used to develop a low-order model of the three-body articulating Galileo spacecraft.

Spanos, John T.↗
NASA NTRS1963

ADVANCED VALVE TECHNOLOGY FOR SPACECRAFT ENGINES FINAL REPORT

This final report describes the work that was done to determine the state-of-the-art of valves required for space exploration vehicles and the steps that were taken to advance the technology. Interviews were held with personnel of major prime manufacturers to determine current problems and current and future requirements. Manufacturers were surveyed by mail to determine what equipment is presently being produced. An extensive search of patent office files was made to determine if any novel valve concepts not already applied to aerospace valves might exist. A literature search was conducted to provide the necessary technical information that was required for the program. Several extensive studies were made to determine the effects on materials resulting from use in space applications, and an investigation of the basic phenomena of valve seat wear was initiated. With the information developed in the surveys and studies, the significant problems associated with valves were identified and are described under "Discussion of Problems. " A novel valve concept was developed and a prototype valve was built and successfully tested. A seal compound of Teflon and stainless steel was developed which possesses superior cold flow characteristics while retaining the desirable properties of the basic Teflon material.

Spacecraft propulsion↗
NASA NTRS1966

Extendible boom device

Expandable boom from metal tape and fasteners for spacecraft applications

SPACECRAFT COMPONENT↗
NASA NTRS1966

Compression-spring separation mechanisms

Theseparationofspacecraftcomponents,whichoccurineveryflight,representscrucialandmajoreventsthatmustbesuccessfullyexecutedtofulfillmissionrequirements.Separationsystemsvaryaswidelyinphysicalandfunctionalpropertiesastheperformancerequirementswhichtheymustsatisfy;however,mostsystemsusehelicalcompressionspringsasanenergysource.Thispapersummarizestheprincipaldesigncharacteristicsofseparationmechanismsandempiricaldataobtainedfromactualseparationsinspace.

SEPARATION↗